Search Antibody, Protein, and ELISA Kit Solutions

NRIP3 Antibody - middle region (ARP50643_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP50643_P050-FITC Conjugated

ARP50643_P050-HRP Conjugated

ARP50643_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NRIP3
Official Gene Full Name:
Nuclear receptor interacting protein 3
NCBI Gene Id:
56675
Protein Name:
Nuclear receptor-interacting protein 3
Swissprot Id:
Q9NQ35
Protein Accession #:
NP_065696
Nucleotide Accession #:
NM_020645
Alias Symbols:
C11orf14, NY-SAR-105
Replacement Item:
This antibody may replace item sc-133847 from Santa Cruz Biotechnology.
Description of Target:
The exact functions of NRIP3 remain unknown.
Protein Size (# AA):
241
Molecular Weight:
27kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NRIP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NRIP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NRIP3
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-NRIP3 (ARP50643_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCDC155; CFTR; ELAVL1;
Blocking Peptide:
For anti-NRIP3 (ARP50643_P050) antibody is Catalog # AAP50643 (Previous Catalog # AAPY03380)
Datasheets/Manuals:
Printable datasheet for anti-NRIP3 (ARP50643_P050) antibody
Sample Type Confirmation:

NRIP3 is supported by BioGPS gene expression data to be expressed in PANC1

Target Reference:
Lee,S.Y., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2651-2656

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...