Search Antibody, Protein, and ELISA Kit Solutions

Nrip2 Antibody - N-terminal region (ARP37305_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37305_P050-FITC Conjugated

ARP37305_P050-HRP Conjugated

ARP37305_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Nuclear receptor interacting protein 2
NCBI Gene Id:
Protein Name:
Nuclear receptor-interacting protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AW491344, MGC144354, NIX1
Replacement Item:
This antibody may replace item sc-133846 from Santa Cruz Biotechnology.
Description of Target:
NIX1 holds two copies of the LXXLL motif. NIX1 displays a neuronal specific expression pattern. It selectively interacts with distinct nuclear receptors of the RAR and TR subfamily, but does not bind steroid hormone receptors. By docking to activated nuclear receptors in an AF2-D-dependent fashion, NIX1 might displace coactivators and result in suppression of the transcriptional activity of liganded nuclear receptors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Nrip2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Nrip2.
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Nrip2
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Horse: 86%; Human: 93%; Mouse: 100%; Pig: 77%; Rabbit: 85%; Rat: 93%
Complete computational species homology data:
Anti-Nrip2 (ARP37305_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSTGQEARRDEGDSRKEQEASLRDRAHLSQQRQLKQATQFLHKDSADLLP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Rorb; Thrb; Rara;
Blocking Peptide:
For anti-Nrip2 (ARP37305_P050) antibody is Catalog # AAP37305 (Previous Catalog # AAPP09273)
Printable datasheet for anti-Nrip2 (ARP37305_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...