Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF08052
Size:100 ug
Price: $344.00
SKU
OAAF08052
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for NRG2 Antibody (OAAF08052)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from the Internal region of human NRG2.
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide SequenceSynthetic peptide located within the following region: YIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTIT
Concentration1mg/ml
SpecificityNRG2 Antibody detects endogenous levels of NRG2 protein.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
ELISA: 1:10000
Gene SymbolNRG2
Gene Full Nameneuregulin 2
Alias Symbolsdivergent of neuregulin-1;DON1;HRG2;neural- and thymus-derived activator for ErbB kinases;NTAK;pro-neuregulin-2, membrane-bound isoform;pro-NRG2.
NCBI Gene Id9542
Protein NamePro-neuregulin-2, membrane-bound isoform
Description of TargetDirect ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Uniprot IDO14511
Molecular Weight91 kDa
  1. What is the species homology for "NRG2 Antibody (OAAF08052)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "NRG2 Antibody (OAAF08052)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "NRG2 Antibody (OAAF08052)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NRG2 Antibody (OAAF08052)"?

    This target may also be called "divergent of neuregulin-1;DON1;HRG2;neural- and thymus-derived activator for ErbB kinases;NTAK;pro-neuregulin-2, membrane-bound isoform;pro-NRG2." in publications.

  5. What is the shipping cost for "NRG2 Antibody (OAAF08052)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NRG2 Antibody (OAAF08052)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NRG2 Antibody (OAAF08052)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "91 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NRG2 Antibody (OAAF08052)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NRG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NRG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NRG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NRG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NRG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NRG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NRG2 Antibody (OAAF08052)
Your Rating
We found other products you might like!