- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for NRG2 Antibody (OAAF08052) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human NRG2. |
Purification | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide. |
Peptide Sequence | Synthetic peptide located within the following region: YIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTIT |
Concentration | 1mg/ml |
Specificity | NRG2 Antibody detects endogenous levels of NRG2 protein. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | WB: 1:500~1:1000 ELISA: 1:10000 |
Gene Symbol | NRG2 |
---|---|
Gene Full Name | neuregulin 2 |
Alias Symbols | divergent of neuregulin-1;DON1;HRG2;neural- and thymus-derived activator for ErbB kinases;NTAK;pro-neuregulin-2, membrane-bound isoform;pro-NRG2. |
NCBI Gene Id | 9542 |
Protein Name | Pro-neuregulin-2, membrane-bound isoform |
Description of Target | Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
Uniprot ID | O14511 |
Molecular Weight | 91 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NRG2 Antibody (OAAF08052)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "NRG2 Antibody (OAAF08052)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "NRG2 Antibody (OAAF08052)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NRG2 Antibody (OAAF08052)"?
This target may also be called "divergent of neuregulin-1;DON1;HRG2;neural- and thymus-derived activator for ErbB kinases;NTAK;pro-neuregulin-2, membrane-bound isoform;pro-NRG2." in publications.
-
What is the shipping cost for "NRG2 Antibody (OAAF08052)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NRG2 Antibody (OAAF08052)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NRG2 Antibody (OAAF08052)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "91 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NRG2 Antibody (OAAF08052)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NRG2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NRG2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NRG2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NRG2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NRG2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NRG2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.