NRG1 Protein (OPPA00668)

Catalog No: OPPA00668 (Formerly GWB-85778E)

Size:10UG

Product Info

• Predicted Species Reactivity: Human
• Product Format: Lyophilized from a 0.2um filtered solution (0.25mg/ml) in 20mM PB, pH 7.0, containing 0.5%HSA and 2% mannitol. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Host: E. Coli
• Additional Information: Solubility: It is recommended to reconstitute the lyophilized NRG1 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
  Biological Activity: The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2x10⁴ Units/mg.
  Product Introduction: Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that neuregulin recombinant could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that neuregulin (NRG1) recombinant can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.
  Product Description: Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7055 Dalton. NRG-1 is purified by proprietary chromatographic techniques.
• Reconstitution and Storage: Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Heregulin should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.
• Purity: Greater than 96.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Peptide Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.

Target Info

• Gene Symbol: NRG1
• Alias Symbols: GGF, HGL, HRG, NDF, ARIA, GGF2, HRG1, HRGA, SMDF, MST131, MSTP131, NRG1-IT2
• NCBI Gene Id: 3084
• Protein Name: Pro-neuregulin-1, membrane-bound isoform
• Description of Target: Recombinant Human Neuregulin-1/Heregulin-b2
• Uniprot ID: Q15491
• Protein Accession #: NP_001153467.1
• Protein Size (# AA): Recombinant