NRCAM Antibody - C-terminal region (ARP89662_P050)

Catalog No: ARP89662_P050

Host: Rabbit
Target Name: NRCAM
Sample Tissue: Mouse Spleen lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse NRCAM
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NRCAM (ARP89662_P050) antibody is Catalog # AAP89662

Target Info

• Gene Symbol: NRCAM
• Gene Full Name: neuronal cell adhesion molecule
• Alias Symbols: B, Bravo, mKIAA0343, C030017F07Rik, C130076O07Rik
• NCBI Gene Id: 319504
• Protein Name: neuronal cell adhesion molecule
• Description of Target: Cell adhesion protein that is required for normal responses to cell-cell contacts in brain and in the peripheral nervous system. Plays a role in neurite outgrowth in response to contactin binding. Plays a role in mediating cell-cell contacts between Schwann cells and axons. Plays a role in the formation and maintenance of the nodes of Ranvier on myelinated axons. Nodes of Ranvier contain clustered sodium channels that are crucial for the saltatory propagation of action potentials along myelinated axons. During development, nodes of Ranvier are formed by the fusion of two heminodes. Required for normal clustering of sodium channels at heminodes; not required for the formation of mature nodes with normal sodium channel clusters. Required, together with GLDN, for maintaining NFASC and sodium channel clusters at mature nodes of Ranvier.
• Uniprot ID: Q810U4
• Protein Accession #: NP_001139503.1
• Nucleotide Accession #: NM_001146031.1
• Protein Size (# AA): 1256
• Molecular Weight: 138 kDa