Search Antibody, Protein, and ELISA Kit Solutions

Nrbf2 Antibody - N-terminal region (ARP42659_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42659_P050-FITC Conjugated

ARP42659_P050-HRP Conjugated

ARP42659_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Nrbf2
Official Gene Full Name:
Nuclear receptor binding factor 2
NCBI Gene Id:
641340
Protein Name:
Nuclear receptor-binding factor 2
Swissprot Id:
Q8VCQ3
Protein Accession #:
NP_001031370
Nucleotide Accession #:
NM_001036293
Alias Symbols:
NRBF-2
Replacement Item:
This antibody may replace item sc-365213 from Santa Cruz Biotechnology.
Description of Target:
Nrbf2 may modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).
Protein Size (# AA):
287
Molecular Weight:
32kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Nrbf2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Nrbf2.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Complete computational species homology data:
Anti-Nrbf2 (ARP42659_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAH
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRKAA1;
Blocking Peptide:
For anti-Nrbf2 (ARP42659_P050) antibody is Catalog # AAP42659
Datasheets/Manuals:
Printable datasheet for anti-Nrbf2 (ARP42659_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...