Search Antibody, Protein, and ELISA Kit Solutions

NRBF2 Antibody - middle region (ARP85936_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
nuclear receptor binding factor 2
NCBI Gene Id:
Protein Name:
nuclear receptor-binding factor 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro). Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy. Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3. Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1. May be involved in autophagosome biogenesis. May play a role in neural progenitor cell survival during differentiation.
Protein Size (# AA):
Molecular Weight:
31 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NRBF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NRBF2.
The immunogen is a synthetic peptide directed towards the middle region of human NRBF2
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: EFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NRBF2 (ARP85936_P050) antibody is Catalog # AAP85936
Printable datasheet for anti-NRBF2 (ARP85936_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...