Catalog No: ARP38753_P050
Price: $0.00
SKU
ARP38753_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NR4A2 (ARP38753_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NR4A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTE
Concentration0.5 mg/ml
Blocking PeptideFor anti-NR4A2 (ARP38753_P050) antibody is Catalog # AAP38753 (Previous Catalog # AAPS04510)
ReferenceSmith,A.G., (2008) J. Biol. Chem. 283 (18), 12564-12570
Publications

Epigenetic Reprogramming of Cortical Neurons through Alteration of Dopaminergic Circuits. Mol Psychiatry. 19, 1193-1200 (2014). 25023144

Gene SymbolNR4A2
Gene Full NameNuclear receptor subfamily 4, group A, member 2
Alias SymbolsNOT, RNR1, HZF-3, NURR1, TINUR
NCBI Gene Id4929
Protein NameNuclear receptor subfamily 4 group A member 2
Description of TargetNR4A2 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. The protein may act as a transcription factor. Mutations in NR4A2 gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of NR4A2 gene may be associated with rheumatoid arthritis.This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Four transcript variants encoding four distinct isoforms have been identified for this gene. Additional alternate splice variants may exist, but their full length nature has not been determined.This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP43354
Protein Accession #NP_006177
Nucleotide Accession #NM_006186
Protein Size (# AA)598
Molecular Weight66kDa
Protein InteractionsCDKN2D; TCEAL5; BAZ1B; ELAVL1; COPS5; RXRB; RXRA; RUNX1; SMARCA4; SMARCA2; SIN3A; NCOR2; SFPQ; PIAS4; RPS6KA1; CDKN1C; RARB; RARA; CREB1;
  1. What is the species homology for "NR4A2 Antibody - N-terminal region (ARP38753_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "NR4A2 Antibody - N-terminal region (ARP38753_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NR4A2 Antibody - N-terminal region (ARP38753_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NR4A2 Antibody - N-terminal region (ARP38753_P050)"?

    This target may also be called "NOT, RNR1, HZF-3, NURR1, TINUR" in publications.

  5. What is the shipping cost for "NR4A2 Antibody - N-terminal region (ARP38753_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NR4A2 Antibody - N-terminal region (ARP38753_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NR4A2 Antibody - N-terminal region (ARP38753_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NR4A2 Antibody - N-terminal region (ARP38753_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NR4A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NR4A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NR4A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NR4A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NR4A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NR4A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NR4A2 Antibody - N-terminal region (ARP38753_P050)
Your Rating
We found other products you might like!