Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NR2F6 antibody - N-terminal region (ARP45627_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP45627_P050-FITC Conjugated

ARP45627_P050-HRP Conjugated

ARP45627_P050-Biotin Conjugated

Gene Symbol:
NR2F6
NCBI Gene Id:
2063
Official Gene Full Name:
Nuclear receptor subfamily 2, group F, member 6
Protein Name:
Nuclear receptor subfamily 2 group F member 6
Swissprot Id:
P10588
Protein Accession #:
NP_005225
Nucleotide Accession #:
NM_005234
Alias Symbols:
EAR-2, EAR2, ERBAL2
Replacement Item:
This antibody may replace item sc-112405 from Santa Cruz Biotechnology.
Description of Target:
Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).
Protein Size (# AA):
404
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR2F6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR2F6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-NR2F6 (ARP45627_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NSD1; BCL11A; CBX1; NAP1L1; UBC; TFAP4; NR2F2; THRB; ANGPTL1; NCOA1; NR3C1; ESR1; NR2F6; RARG; RXRA;
Blocking Peptide:
For anti-NR2F6 (ARP45627_P050) antibody is Catalog # AAP45627 (Previous Catalog # AAPP11910)
Datasheets/Manuals:
Printable datasheet for anti-NR2F6 (ARP45627_P050) antibody
Sample Type Confirmation:

NR2F6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Tell us what you think about this item!

Write A Review
    Please, wait...