Search Antibody, Protein, and ELISA Kit Solutions

NR2F6 Antibody - N-terminal region (ARP45627_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45627_P050-FITC Conjugated

ARP45627_P050-HRP Conjugated

ARP45627_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Nuclear receptor subfamily 2, group F, member 6
NCBI Gene Id:
Protein Name:
Nuclear receptor subfamily 2 group F member 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-112405 from Santa Cruz Biotechnology.
Description of Target:
Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR2F6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR2F6.
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-NR2F6 (ARP45627_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NR2F6 (ARP45627_P050) antibody is Catalog # AAP45627 (Previous Catalog # AAPP11910)
Printable datasheet for anti-NR2F6 (ARP45627_P050) antibody
Sample Type Confirmation:

NR2F6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...