Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP32256_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32256_P050-FITC Conjugated

ARP32256_P050-HRP Conjugated

ARP32256_P050-Biotin Conjugated

NR2F6 Antibody - N-terminal region (ARP32256_P050)

Catalog#: ARP32256_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-112405 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 87%; Rat: 87%
Complete computational species homology data Anti-NR2F6 (ARP32256_P050)
Peptide Sequence Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NR2F6 (ARP32256_P050) antibody is Catalog # AAP32256
Datasheets/Manuals Printable datasheet for anti-NR2F6 (ARP32256_P050) antibody
Gene Symbol NR2F6
Official Gene Full Name Nuclear receptor subfamily 2, group F, member 6
Alias Symbols EAR2, EAR-2, ERBAL2
NCBI Gene Id 2063
Protein Name Nuclear receptor subfamily 2 group F member 6
Description of Target NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
Swissprot Id P10588
Protein Accession # NP_005225
Nucleotide Accession # NM_005234
Protein Size (# AA) 404
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NR2F6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NR2F6.
Protein Interactions NSD1; BCL11A; CBX1; NAP1L1; UBC; TFAP4; NR2F2; THRB; ANGPTL1; NCOA1; NR3C1; ESR1; NR2F6; RARG; RXRA;
Write Your Own Review
You're reviewing:NR2F6 Antibody - N-terminal region (ARP32256_P050)
Your Rating