- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for NR2F2 Antibody (OAAL00338) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 3B5 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | NR2F2 (NP_066285, 153 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | NR2F2 |
|---|---|
| Gene Full Name | nuclear receptor subfamily 2 group F member 2 |
| Alias Symbols | ADP-ribosylation factor related protein 1;apolipoprotein AI regulatory protein 1;apolipoprotein A-I regulatory protein 1;ARP1;ARP-1;chicken ovalbumin upstream promoter transcription factor 2;chicken ovalbumin upstream promoter-transcription factor I;CHTD4;COUP transcription factor 2;COUP transcription factor II;COUPTF2;COUPTFB;COUPTFII;NF-E3;SRXX5;SVP40;TFCOUP2. |
| NCBI Gene Id | 7026 |
| Protein Name | COUP transcription factor 2 isoform a [Homo sapiens]|Homo sapiens nuclear receptor subfamily 2 group F member 2 (NR2F2), transcript variant 1, mRNA |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_066285 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_021005 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NR2F2 Antibody (OAAL00338)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "NR2F2 Antibody (OAAL00338)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "NR2F2 Antibody (OAAL00338)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NR2F2 Antibody (OAAL00338)"?
This target may also be called "ADP-ribosylation factor related protein 1;apolipoprotein AI regulatory protein 1;apolipoprotein A-I regulatory protein 1;ARP1;ARP-1;chicken ovalbumin upstream promoter transcription factor 2;chicken ovalbumin upstream promoter-transcription factor I;CHTD4;COUP transcription factor 2;COUP transcription factor II;COUPTF2;COUPTFB;COUPTFII;NF-E3;SRXX5;SVP40;TFCOUP2." in publications.
-
What is the shipping cost for "NR2F2 Antibody (OAAL00338)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NR2F2 Antibody (OAAL00338)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NR2F2 Antibody (OAAL00338)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NR2F2 Antibody (OAAL00338)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NR2F2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NR2F2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NR2F2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NR2F2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NR2F2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NR2F2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
