Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NR2F2 antibody - N-terminal region (P100816_P050)

100 ul
$319.00
In Stock

Conjugation Options

P100816_P050-FITC Conjugated

P100816_P050-HRP Conjugated

P100816_P050-Biotin Conjugated

Gene Symbol:
NR2F2
NCBI Gene Id:
7026
Official Gene Full Name:
Nuclear receptor subfamily 2, group F, member 2
Protein Name:
COUP transcription factor 2
Swissprot Id:
P24468
Protein Accession #:
NP_066285
Nucleotide Accession #:
NM_021005
Alias Symbols:
ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2, NF-E3, NR2F1, COUPTFII
Replacement Item:
This antibody may replace item sc-271264 from Santa Cruz Biotechnology.
Description of Target:
NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Protein Size (# AA):
414
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR2F2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR2F2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2
Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 92%
Complete computational species homology data:
Anti-NR2F2 (P100816_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK;
Blocking Peptide:
For anti-NR2F2 (P100816_P050) antibody is Catalog # AAP31163 (Previous Catalog # AAPS22105)
Datasheets/Manuals:
Printable datasheet for anti-NR2F2 (P100816_P050) antibody
Sample Type Confirmation:

NR2F2 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Sato,Y., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420
Publications:

Déjardin, J. & Kingston, R. E. Purification of proteins associated with specific genomic Loci. Cell 136, 175-86 (2009). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish 19135898

Tell us what you think about this item!

Write A Review
    Please, wait...