Search Antibody, Protein, and ELISA Kit Solutions

NR2F2 Antibody - C-terminal region (ARP39466_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39466_T100-FITC Conjugated

ARP39466_T100-HRP Conjugated

ARP39466_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-271264 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NR2F2
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-NR2F2 (ARP39466_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NR2F2 (ARP39466_T100) antibody is Catalog # AAP39466 (Previous Catalog # AAPP21480)
Datasheets/Manuals:
Printable datasheet for anti-NR2F2 (ARP39466_T100) antibody
Target Reference:
Sato,Y., et al., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420
Publications:

Cho, K., Yi, H., Tserentsoodol, N., Searle, K. & Ferreira, P. A. Neuroprotection resulting from insufficiency of RANBP2 is associated with the modulation of protein and lipid homeostasis of functionally diverse but linked pathways in response to oxidative stress. Dis. Model. Mech. 3, 595-604 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20682751

Gene Symbol:
NR2F2
Official Gene Full Name:
Nuclear receptor subfamily 2, group F, member 2
Alias Symbols:
ARP1, NF-E3, NR2F1, SVP40, COUPTFB, TFCOUP2, COUPTFII
NCBI Gene Id:
7026
Protein Name:
COUP transcription factor 2
Description of Target:
NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Swissprot Id:
P24468
Protein Accession #:
NP_066285
Nucleotide Accession #:
NM_021005
Protein Size (# AA):
414
Molecular Weight:
46kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR2F2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR2F2.
Protein Interactions:
NSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...