Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39466_T100-FITC Conjugated

ARP39466_T100-HRP Conjugated

ARP39466_T100-Biotin Conjugated

NR2F2 Antibody - C-terminal region (ARP39466_T100)

Catalog#: ARP39466_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-271264 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NR2F2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data Anti-NR2F2 (ARP39466_T100)
Peptide Sequence Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NR2F2 (ARP39466_T100) antibody is Catalog # AAP39466 (Previous Catalog # AAPP21480)
Datasheets/Manuals Printable datasheet for anti-NR2F2 (ARP39466_T100) antibody
Target Reference Sato,Y., et al., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420

Cho, K., Yi, H., Tserentsoodol, N., Searle, K. & Ferreira, P. A. Neuroprotection resulting from insufficiency of RANBP2 is associated with the modulation of protein and lipid homeostasis of functionally diverse but linked pathways in response to oxidative stress. Dis. Model. Mech. 3, 595-604 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20682751

Gene Symbol NR2F2
Official Gene Full Name Nuclear receptor subfamily 2, group F, member 2
NCBI Gene Id 7026
Protein Name COUP transcription factor 2
Description of Target NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Swissprot Id P24468
Protein Accession # NP_066285
Nucleotide Accession # NM_021005
Protein Size (# AA) 414
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NR2F2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NR2F2.
Protein Interactions NSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK;
  1. What is the species homology for "NR2F2 Antibody - C-terminal region (ARP39466_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "NR2F2 Antibody - C-terminal region (ARP39466_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NR2F2 Antibody - C-terminal region (ARP39466_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "NR2F2 Antibody - C-terminal region (ARP39466_T100)"?

    This target may also be called "ARP1, NF-E3, NR2F1, SVP40, COUPTFB, TFCOUP2, COUPTFII" in publications.

  5. What is the shipping cost for "NR2F2 Antibody - C-terminal region (ARP39466_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NR2F2 Antibody - C-terminal region (ARP39466_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NR2F2 Antibody - C-terminal region (ARP39466_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NR2F2 Antibody - C-terminal region (ARP39466_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NR2F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NR2F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NR2F2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NR2F2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NR2F2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NR2F2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NR2F2 Antibody - C-terminal region (ARP39466_T100)
Your Rating
We found other products you might like!