Search Antibody, Protein, and ELISA Kit Solutions

NR2F2 antibody - C-terminal region (ARP39466_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39466_T100-FITC Conjugated

ARP39466_T100-HRP Conjugated

ARP39466_T100-Biotin Conjugated

Gene Symbol:
NR2F2
NCBI Gene Id:
7026
Official Gene Full Name:
Nuclear receptor subfamily 2, group F, member 2
Protein Name:
COUP transcription factor 2
Swissprot Id:
P24468
Protein Accession #:
NP_066285
Nucleotide Accession #:
NM_021005
Alias Symbols:
ARP1, NF-E3, NR2F1, SVP40, COUPTFB, TFCOUP2, COUPTFII
Replacement Item:
This antibody may replace item sc-271264 from Santa Cruz Biotechnology.
Description of Target:
NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Protein Size (# AA):
414
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR2F2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR2F2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NR2F2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-NR2F2 (ARP39466_T100)
Peptide Sequence:
Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK;
Blocking Peptide:
For anti-NR2F2 (ARP39466_T100) antibody is Catalog # AAP39466 (Previous Catalog # AAPP21480)
Datasheets/Manuals:
Printable datasheet for anti-NR2F2 (ARP39466_T100) antibody
Target Reference:
Sato,Y., et al., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420
Publications:

Cho, K., Yi, H., Tserentsoodol, N., Searle, K. & Ferreira, P. A. Neuroprotection resulting from insufficiency of RANBP2 is associated with the modulation of protein and lipid homeostasis of functionally diverse but linked pathways in response to oxidative stress. Dis. Model. Mech. 3, 595-604 WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20682751

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...