- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)
Datasheets/Manuals | Printable datasheet for anti-NR2C1 (P100813_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NR2C1 |
Predicted Homology Based on Immunogen Sequence | Cow: 80%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: ELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIFK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-NR2C1 (P100813_P050-FITC) antibody is Catalog # AAP31157 (Previous Catalog # AAPP01896) |
Sample Type Confirmation | NR2C1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Reference | Lin,Y.L., (2006) Biochem. Biophys. Res. Commun. 350 (2), 430-436 |
Gene Symbol | NR2C1 |
---|---|
Gene Full Name | Nuclear receptor subfamily 2, group C, member 1 |
Alias Symbols | TR2 |
NCBI Gene Id | 7181 |
Protein Name | Nuclear receptor subfamily 2 group C member 1 |
Description of Target | The nuclear orphan receptors NR2C1 represses transcription and binds DNA as a homodimer. NR2C1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism. NR2C1 may function as a negative modulator to suppress androgen receptor function in prostate cancer. NR2C1 may exert an important repressor in regulating ER activity in mammary glands. The nuclear orphan receptors TR2 (NR2C1) and TR4 form a heterodimer that binds to the epsilon and gamma globin promoter DR1 sites This gene encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined. |
Uniprot ID | Q15625 |
Protein Accession # | NP_003288 |
Nucleotide Accession # | NM_003297 |
Protein Size (# AA) | 603 |
Molecular Weight | 67kDa |
Protein Interactions | PSPC1; MBD3; SIN3A; RCOR1; KDM1A; POLD3; TRIM28; RBM39; MTA2; MTA1; HDAC3; NR2C2; SMARCA4; SFPQ; RBBP7; RBBP4; NONO; HDAC2; HDAC1; HCFC1; DNMT1; CHD4; NUDT3; UBC; PML; HDAC4; NRIP1; AR; ESR1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".
-
How long will it take to receive "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)"?
This target may also be called "TR2" in publications.
-
What is the shipping cost for "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "67kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NR2C1 Antibody - middle region : FITC (P100813_P050-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NR2C1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NR2C1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NR2C1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NR2C1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NR2C1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NR2C1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.