SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP36016_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP36016_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-NR1I2 (ARP36016_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA
Concentration0.5 mg/ml
Blocking PeptideFor anti-NR1I2 (ARP36016_P050-HRP) antibody is Catalog # AAP36016 (Previous Catalog # AAPP07326)
ReferenceHesselink,D.A., (2008) Pharmacogenomics 9 (6), 783-789
Publications

Sivertsson, L., Edebert, I., Palmertz, M. P., Ingelman-Sundberg, M. & Neve, E. P. A. Induced CYP3A4 expression in confluent Huh7 hepatoma cells as a result of decreased cell proliferation and subsequent pregnane X receptor activation. Mol. Pharmacol. 83, 659-70 (2013). WB, IHC, Human 23264496

Dou, W. et al. Chrysin ameliorates chemically induced colitis in the mouse through modulation of a PXR/NF-κB signaling pathway. J. Pharmacol. Exp. Ther. 345, 473-82 (2013). WB, IHC, Human 23536316

Gene SymbolNR1I2
Gene Full NameNuclear receptor subfamily 1, group I, member 2
Alias SymbolsBXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PARq
NCBI Gene Id8856
Protein NameNuclear receptor subfamily 1 group I member 2
Description of TargetNR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. NR1I2 contains a zinc finger domain.NR1I2 is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.
Uniprot IDO75469
Protein Accession #NP_003880
Nucleotide Accession #NM_003889
Protein Size (# AA)434
Molecular Weight50kDa
Protein InteractionsNCOA1; RPS6KB1; UBC; RBBP7; DDB1; UBR5; DYRK2; NCOR2; SDF4; NCOA3; TFAP2C; MAPK7; NFATC4; HSP90AA1; FGR; ATP6AP1; RXRA; RBCK1; NCOA2; SUMO1; SUMO2; SUMO3; NCOA6; SRC; RXRG; RXRB; CHMP1A; NUCB2; ACTN2; PPARGC1A; EIF3I; TADA3; NCOR1; PRMT1; NR1I2; PSMC5; PO
  1. What is the species homology for "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)"?

    This target may also be called "BXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PARq" in publications.

  5. What is the shipping cost for "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NR1I2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NR1I2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NR1I2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NR1I2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NR1I2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NR1I2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NR1I2 Antibody - N-terminal region : HRP (ARP36016_P050-HRP)
Your Rating
We found other products you might like!