Search Antibody, Protein, and ELISA Kit Solutions

NR1I2 Antibody - N-terminal region (ARP36016_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36016_P050-FITC Conjugated

ARP36016_P050-HRP Conjugated

ARP36016_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Nuclear receptor subfamily 1, group I, member 2
NCBI Gene Id:
Protein Name:
Nuclear receptor subfamily 1 group I member 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. NR1I2 contains a zinc finger domain.NR1I2 is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1I2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1I2.
The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-NR1I2 (ARP36016_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NR1I2 (ARP36016_P050) antibody is Catalog # AAP36016 (Previous Catalog # AAPP07326)
Printable datasheet for anti-NR1I2 (ARP36016_P050) antibody
Target Reference:
Hesselink,D.A., (2008) Pharmacogenomics 9 (6), 783-789

Dou, W. et al. Chrysin ameliorates chemically induced colitis in the mouse through modulation of a PXR/NF-κB signaling pathway. J. Pharmacol. Exp. Ther. 345, 473-82 (2013). IHC, WB, Human 23536316

Sivertsson, L., Edebert, I., Palmertz, M. P., Ingelman-Sundberg, M. & Neve, E. P. A. Induced CYP3A4 expression in confluent Huh7 hepatoma cells as a result of decreased cell proliferation and subsequent pregnane X receptor activation. Mol. Pharmacol. 83, 659-70 (2013). IHC, WB, Human 23264496

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...