Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NR1I2 antibody - N-terminal region (ARP36016_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP36016_P050-FITC Conjugated

ARP36016_P050-HRP Conjugated

ARP36016_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NR1I2
NCBI Gene Id:
8856
Official Gene Full Name:
Nuclear receptor subfamily 1, group I, member 2
Protein Name:
Nuclear receptor subfamily 1 group I member 2
Swissprot Id:
O75469
Protein Accession #:
NP_003880
Nucleotide Accession #:
NM_003889
Alias Symbols:
BXR, ONR1, PAR, PAR1, PAR2, PARq, PRR, PXR, SAR, SXR
Description of Target:
NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. NR1I2 contains a zinc finger domain.NR1I2 is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.
Protein Size (# AA):
434
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1I2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1I2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-NR1I2 (ARP36016_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NCOA1; RPS6KB1; UBC; RBBP7; DDB1; UBR5; DYRK2; NCOR2; SDF4; NCOA3; TFAP2C; MAPK7; NFATC4; HSP90AA1; FGR; ATP6AP1; RXRA; RBCK1; NCOA2; SUMO1; SUMO2; SUMO3; NCOA6; SRC; RXRG; RXRB; CHMP1A; NUCB2; ACTN2; PPARGC1A; EIF3I; TADA3; NCOR1; PRMT1; NR1I2; PSMC5; PO
Blocking Peptide:
For anti-NR1I2 (ARP36016_P050) antibody is Catalog # AAP36016 (Previous Catalog # AAPP07326)
Datasheets/Manuals:
Printable datasheet for anti-NR1I2 (ARP36016_P050) antibody
Target Reference:
Hesselink,D.A., (2008) Pharmacogenomics 9 (6), 783-789
Publications:

Sivertsson, L., Edebert, I., Palmertz, M. P., Ingelman-Sundberg, M. & Neve, E. P. A. Induced CYP3A4 expression in confluent Huh7 hepatoma cells as a result of decreased cell proliferation and subsequent pregnane X receptor activation. Mol. Pharmacol. 83, 659-70 (2013). IHC, WB, Human 23264496

Dou, W. et al. Chrysin ameliorates chemically induced colitis in the mouse through modulation of a PXR/NF-κB signaling pathway. J. Pharmacol. Exp. Ther. 345, 473-82 (2013). IHC, WB, Human 23536316

Tell us what you think about this item!

Write A Review
    Please, wait...