Search Antibody, Protein, and ELISA Kit Solutions

NR1H4 Antibody - middle region (ARP45626_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45626_P050-FITC Conjugated

ARP45626_P050-HRP Conjugated

ARP45626_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 4
NCBI Gene Id:
Protein Name:
Farnesoid X receptor EMBL BAH02290.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BAR, FXR, HRR-1, HRR1, MGC163445, RIP14
Description of Target:
NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression, via two d
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1H4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1H4.
The immunogen is a synthetic peptide directed towards the middle region of human NR1H4
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-NR1H4 (ARP45626_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NR1H4 (ARP45626_P050) antibody is Catalog # AAP45626 (Previous Catalog # AAPP11909)
Printable datasheet for anti-NR1H4 (ARP45626_P050) antibody
Target Reference:
Kaeding,J., (2008) Biochem. J. 410 (2), 245-253

Yamada, T. et al. Guggulsterone suppresses bile acid-induced and constitutive caudal-related homeobox 2 expression in gut-derived adenocarcinoma cells. Anticancer Res. 30, 1953-60 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 20651339

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...