Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP45626_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45626_P050-FITC Conjugated

ARP45626_P050-HRP Conjugated

ARP45626_P050-Biotin Conjugated

NR1H4 Antibody - middle region (ARP45626_P050)

Catalog#: ARP45626_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NR1H4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-NR1H4 (ARP45626_P050)
Peptide SequenceSynthetic peptide located within the following region: SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-NR1H4 (ARP45626_P050) antibody is Catalog # AAP45626 (Previous Catalog # AAPP11909)
Datasheets/ManualsPrintable datasheet for anti-NR1H4 (ARP45626_P050) antibody
Target ReferenceKaeding,J., (2008) Biochem. J. 410 (2), 245-253
Publications

Yamada, T. et al. Guggulsterone suppresses bile acid-induced and constitutive caudal-related homeobox 2 expression in gut-derived adenocarcinoma cells. Anticancer Res. 30, 1953-60 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 20651339

Gene SymbolNR1H4
Official Gene Full NameNuclear receptor subfamily 1, group H, member 4
Alias SymbolsBAR, FXR, HRR-1, HRR1, MGC163445, RIP14
NCBI Gene Id9971
Protein NameFarnesoid X receptor EMBL BAH02290.1
Description of TargetNR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression, via two d
Swissprot IdB6ZGS9
Protein Accession #NP_005114
Nucleotide Accession #NM_005123
Protein Size (# AA)472
Molecular Weight54kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express NR1H4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express NR1H4.
Protein InteractionsSMARCD3; HDAC6; SUMO1; NCOR2; ESR1; RRM2; GPS2; RXRG; GAPDH; RXRA; EP300; SIRT1; SRC; NCOA6; CARM1; HIST1H4A; HIST1H3A; PRMT1; NCOR1; XRCC5; PRKDC; XRCC6; NCOA1; CASP8; SMARCD1;
Write Your Own Review
You're reviewing:NR1H4 Antibody - middle region (ARP45626_P050)
Your Rating
Free Microscope
Aviva Travel Grant
Aviva ChIP Antibodies
Aviva Blast Tool