Search Antibody, Protein, and ELISA Kit Solutions

NR1H3 Antibody - C-terminal region (ARP38670_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38670_P050-FITC Conjugated

ARP38670_P050-HRP Conjugated

ARP38670_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NR1H3
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-NR1H3 (ARP38670_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NR1H3 (ARP38670_P050) antibody is Catalog # AAP38670 (Previous Catalog # AAPP20859)
Datasheets/Manuals:
Printable datasheet for anti-NR1H3 (ARP38670_P050) antibody
Target Reference:
Torra,I.P., (2008) Mol. Cell. Biol. 28 (8), 2626-2636
Gene Symbol:
NR1H3
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 3
Alias Symbols:
LXR-a, LXRA, RLD-1
NCBI Gene Id:
10062
Protein Name:
Oxysterols receptor LXR-alpha
Description of Target:
Interaction of NR1H3 with RXR shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. NR1H3 are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. NR1H3 Plays an important role in the regulation of cholesterol homeostasis.
Swissprot Id:
Q13133
Protein Accession #:
NP_005684
Nucleotide Accession #:
NM_005693
Protein Size (# AA):
447
Molecular Weight:
50kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1H3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1H3.
Protein Interactions:
RXRG; RXRB; MDFI; SUV39H1; KDM1A; BARD1; MSTO1; HSP90AA1; PIAS1; APP; NR3C1; MYC; ZXDC; TMEM161A; ING3; NCOA6; NCOR1; KAT2B; EIF3I; NRIP1; NCOA3; SRC; RXRA; FOXO3; ACTN1; SS18L1; LZTR1; EDF1; RARA; NR0B2; SYT1; PPARA; SIRT1; UBC; CEP350;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...