Nr1h3 Antibody - C-terminal region (ARP32674_P050)

Catalog No: ARP32674_P050

WB Suggested Anti-Nr1h3 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Nr1h3 (ARP32674_P050) antibody is Catalog # AAP32674
• Publications:

  Anti-Nr1h3 ARP32674_P050 has recently been referenced in the following publications:

  1. Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225–38 (2013). WB, IP, ICC/IF, Mouse, Human 23931754

Target Info

• Gene Symbol: Nr1h3
• Gene Full Name: Nuclear receptor subfamily 1, group H, member 3
• Alias Symbols: Un, LXR, RLD1, Unr1, AU018371
• NCBI Gene Id: 22259
• Protein Name: Oxysterols receptor LXR-alpha
• Description of Target: Nr1h3 is an orphan receptor. Interaction with RXR shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. LXRES are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. Nr1h3 plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8.
• Uniprot ID: Q9Z0Y9
• Protein Accession #: NP_038867
• Nucleotide Accession #: NM_013839
• Protein Size (# AA): 445
• Molecular Weight: 50kDa
• Protein Interactions: Ncor1; Ppargc1b; Zfp111; Rxrg; Rxra; Ppargc1a; Ubc;