Search Antibody, Protein, and ELISA Kit Solutions

NR1H2 Antibody - N-terminal region (ARP38906_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38906_T100-FITC Conjugated

ARP38906_T100-HRP Conjugated

ARP38906_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 2
NCBI Gene Id:
Protein Name:
Putative uncharacterized protein DKFZp686D1580 EMBL CAH18442.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Description of Target:
The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1H2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1H2.
The immunogen is a synthetic peptide directed towards the N terminal region of human NR1H2
Predicted Homology Based on Immunogen Sequence:
Dog: 90%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rat: 86%
Complete computational species homology data:
Anti-NR1H2 (ARP38906_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NR1H2 (ARP38906_T100) antibody is Catalog # AAP38906 (Previous Catalog # AAPY00715)
Printable datasheet for anti-NR1H2 (ARP38906_T100) antibody
Application Info:
Target Reference:
Albers,M., (2006) J. Biol. Chem. 281 (8), 4920-4930

Bogan, R. L. & Hennebold, J. D. The reverse cholesterol transport system as a potential mediator of luteolysis in the primate corpus luteum. Reproduction 139, 163-76 (2010). WB, Dog, Guinea Pig, Horse, Human, Rat 19776099

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...