Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38906_T100-FITC Conjugated

ARP38906_T100-HRP Conjugated

ARP38906_T100-Biotin Conjugated

NR1H2 Antibody - N-terminal region (ARP38906_T100)

Catalog#: ARP38906_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR1H2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Dog: 90%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rat: 86%
Complete computational species homology data Anti-NR1H2 (ARP38906_T100)
Peptide Sequence Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NR1H2 (ARP38906_T100) antibody is Catalog # AAP38906 (Previous Catalog # AAPY00715)
Datasheets/Manuals Printable datasheet for anti-NR1H2 (ARP38906_T100) antibody
Application Info ChIP
Target Reference Albers,M., (2006) J. Biol. Chem. 281 (8), 4920-4930

Bogan, R. L. & Hennebold, J. D. The reverse cholesterol transport system as a potential mediator of luteolysis in the primate corpus luteum. Reproduction 139, 163-76 (2010). WB, Dog, Guinea Pig, Horse, Human, Rat 19776099

Gene Symbol NR1H2
Official Gene Full Name Nuclear receptor subfamily 1, group H, member 2
Alias Symbols LXR-b, LXRB, NER, NER-I, RIP15, UNR
NCBI Gene Id 7376
Protein Name Putative uncharacterized protein DKFZp686D1580 EMBL CAH18442.1
Description of Target The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995).[supplied by OMIM].
Swissprot Id Q68CY8
Protein Accession # NP_009052
Nucleotide Accession # NM_007121
Protein Size (# AA) 460
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NR1H2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NR1H2.
  1. What is the species homology for "NR1H2 Antibody - N-terminal region (ARP38906_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Rat".

  2. How long will it take to receive "NR1H2 Antibody - N-terminal region (ARP38906_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NR1H2 Antibody - N-terminal region (ARP38906_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "NR1H2 Antibody - N-terminal region (ARP38906_T100)"?

    This target may also be called "LXR-b, LXRB, NER, NER-I, RIP15, UNR" in publications.

  5. What is the shipping cost for "NR1H2 Antibody - N-terminal region (ARP38906_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NR1H2 Antibody - N-terminal region (ARP38906_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NR1H2 Antibody - N-terminal region (ARP38906_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NR1H2 Antibody - N-terminal region (ARP38906_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NR1H2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NR1H2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NR1H2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NR1H2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NR1H2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NR1H2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NR1H2 Antibody - N-terminal region (ARP38906_T100)
Your Rating
We found other products you might like!