Search Antibody, Protein, and ELISA Kit Solutions

NR1H2 Antibody - N-terminal region (ARP38906_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38906_T100-FITC Conjugated

ARP38906_T100-HRP Conjugated

ARP38906_T100-Biotin Conjugated

Gene Symbol:
NR1H2
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 2
NCBI Gene Id:
7376
Protein Name:
Putative uncharacterized protein DKFZp686D1580 EMBL CAH18442.1
Swissprot Id:
Q68CY8
Protein Accession #:
NP_009052
Nucleotide Accession #:
NM_007121
Alias Symbols:
LXR-b, LXRB, NER, NER-I, RIP15, UNR
Replacement Item:
This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Description of Target:
The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995).[supplied by OMIM].
Protein Size (# AA):
460
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1H2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1H2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NR1H2
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 90%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rat: 86%
Complete computational species homology data:
Anti-NR1H2 (ARP38906_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RXRG; MDFI; KDM1A; SUV39H1; ACVRL1; LAMC3; NCOR2; YY1; NPY; CDKN1A; PPARGC1B; PDCD4; PIAS1; USP7; PRKCA; SENP3; CORO2A; MPP1; COL4A5; CHD3; RMI1; CSAD; DUSP12; C14orf1; FAF1; SPRY2; HMGXB4; SORBS2; BAG6; VIM; UBE2D1; SMPD1; ROBO2; NCOR1; NRIP1; NCOA3; VDR
Blocking Peptide:
For anti-NR1H2 (ARP38906_T100) antibody is Catalog # AAP38906 (Previous Catalog # AAPY00715)
Datasheets/Manuals:
Printable datasheet for anti-NR1H2 (ARP38906_T100) antibody
Application Info:
ChIP
Target Reference:
Albers,M., (2006) J. Biol. Chem. 281 (8), 4920-4930
Publications:

Bogan, R. L. & Hennebold, J. D. The reverse cholesterol transport system as a potential mediator of luteolysis in the primate corpus luteum. Reproduction 139, 163-76 (2010). WB, Dog, Guinea Pig, Horse, Human, Rat 19776099

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...