Search Antibody, Protein, and ELISA Kit Solutions

NR1H2 Antibody - middle region : HRP (ARP33481_P050-HRP)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33481_P050 Unconjugated

ARP33481_P050-FITC Conjugated

ARP33481_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NR1H2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NR1H2 (ARP33481_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYAL
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-NR1H2 (ARP33481_P050-HRP) antibody is Catalog # AAP33481 (Previous Catalog # AAPP04531)
Datasheets/Manuals:
Printable datasheet for anti-NR1H2 (ARP33481_P050-HRP) antibody
Target Reference:
Schmuth,M., (2008) J. Lipid Res. 49 (3), 499-509
Publications:

Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, IP, ICC/IF, Rat, Human, Rabbit, Dog, Pig, Horse, Bovine, Guinea pig, Mouse 23931754

Gene Symbol:
NR1H2
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 2
Alias Symbols:
LXR-b, LXRB, NER, NER-I, RIP15, UNR
NCBI Gene Id:
7376
Protein Name:
Oxysterols receptor LXR-beta
Description of Target:
NR1H2 is an orphan receptor. NR1H2 binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4).The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995 [PubMed 7625741]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
P55055
Protein Accession #:
NP_009052
Nucleotide Accession #:
NM_007121
Protein Size (# AA):
461
Molecular Weight:
51kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1H2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1H2.
Protein Interactions:
RXRG; MDFI; KDM1A; SUV39H1; ACVRL1; LAMC3; NCOR2; YY1; NPY; CDKN1A; PPARGC1B; PDCD4; PIAS1; USP7; PRKCA; SENP3; CORO2A; MPP1; COL4A5; CHD3; RMI1; CSAD; DUSP12; C14orf1; FAF1; SPRY2; HMGXB4; SORBS2; BAG6; VIM; UBE2D1; SMPD1; ROBO2; NCOR1; NRIP1; NCOA3; VDR

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...