Search Antibody, Protein, and ELISA Kit Solutions

NR1H2 Antibody - middle region (ARP45633_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45633_T100-FITC Conjugated

ARP45633_T100-HRP Conjugated

ARP45633_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NR1H2
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NR1H2 (ARP45633_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NR1H2 (ARP45633_T100) antibody is Catalog # AAP45633 (Previous Catalog # AAPP11916)
Datasheets/Manuals:
Printable datasheet for anti-NR1H2 (ARP45633_T100) antibody
Target Reference:
Albers,M., (2006) J. Biol. Chem. 281 (8), 4920-4930
Gene Symbol:
NR1H2
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 2
Alias Symbols:
LXR-b, LXRB, NER, NER-I, RIP15, UNR
NCBI Gene Id:
7376
Protein Name:
Oxysterols receptor LXR-beta
Description of Target:
The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins.The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995).[supplied by OMIM].
Swissprot Id:
P55055
Protein Accession #:
NP_009052
Nucleotide Accession #:
NM_007121
Protein Size (# AA):
461
Molecular Weight:
51kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1H2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1H2.
Protein Interactions:
RXRG; MDFI; KDM1A; SUV39H1; ACVRL1; LAMC3; NCOR2; YY1; NPY; CDKN1A; PPARGC1B; PDCD4; PIAS1; USP7; PRKCA; SENP3; CORO2A; MPP1; COL4A5; CHD3; RMI1; CSAD; DUSP12; C14orf1; FAF1; SPRY2; HMGXB4; SORBS2; BAG6; VIM; UBE2D1; SMPD1; ROBO2; NCOR1; NRIP1; NCOA3; VDR

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...