Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33481_P050-FITC Conjugated

ARP33481_P050-HRP Conjugated

ARP33481_P050-Biotin Conjugated

NR1H2 Antibody - middle region (ARP33481_P050)

Catalog#: ARP33481_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NR1H2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-NR1H2 (ARP33481_P050)
Peptide Sequence Synthetic peptide located within the following region: ETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYAL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NR1H2 (ARP33481_P050) antibody is Catalog # AAP33481 (Previous Catalog # AAPP04531)
Datasheets/Manuals Printable datasheet for anti-NR1H2 (ARP33481_P050) antibody
Target Reference Schmuth,M., (2008) J. Lipid Res. 49 (3), 499-509

Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23931754

Gene Symbol NR1H2
Official Gene Full Name Nuclear receptor subfamily 1, group H, member 2
Alias Symbols LXR-b, LXRB, NER, NER-I, RIP15, UNR
NCBI Gene Id 7376
Protein Name Oxysterols receptor LXR-beta
Description of Target NR1H2 is an orphan receptor. NR1H2 binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4).The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995 [PubMed 7625741]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P55055
Protein Accession # NP_009052
Nucleotide Accession # NM_007121
Protein Size (# AA) 461
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NR1H2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NR1H2.
Write Your Own Review
You're reviewing:NR1H2 Antibody - middle region (ARP33481_P050)
Your Rating