Search Antibody, Protein, and ELISA Kit Solutions

NR1H2 Antibody - middle region (ARP33481_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33481_P050-FITC Conjugated

ARP33481_P050-HRP Conjugated

ARP33481_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Nuclear receptor subfamily 1, group H, member 2
NCBI Gene Id:
Protein Name:
Oxysterols receptor LXR-beta
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1000 from Santa Cruz Biotechnology.
Description of Target:
NR1H2 is an orphan receptor. NR1H2 binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4).The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995 [PubMed 7625741]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1H2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1H2.
The immunogen is a synthetic peptide directed towards the middle region of human NR1H2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NR1H2 (ARP33481_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYAL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NR1H2 (ARP33481_P050) antibody is Catalog # AAP33481 (Previous Catalog # AAPP04531)
Printable datasheet for anti-NR1H2 (ARP33481_P050) antibody
Target Reference:
Schmuth,M., (2008) J. Lipid Res. 49 (3), 499-509

Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23931754

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...