Search Antibody, Protein, and ELISA Kit Solutions

NR1D2 Antibody - N-terminal region : FITC (ARP74677_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74677_P050 Unconjugated

ARP74677_P050-HRP Conjugated

ARP74677_P050-Biotin Conjugated

Gene Symbol:
NR1D2
NCBI Gene Id:
9975
Swissprot Id:
Q14995
Protein Accession #:
NP_005117
Alias Symbols:
NR1D2,
Replacement Item:
This antibody may replace item sc-100911 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.
Protein Size (# AA):
579
Molecular Weight:
63kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR1D2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR1D2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NR1D2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
MID2; RBPMS; TRIM27; NOTCH2NL; KRTAP10-9; KRT40; KRTAP4-2; PRMT6; SKP1; UBC; SIN3B; KAT5; NCOR1; TAF9; TAF6; HDAC1; GTF2B; NCOA5; UBE2I; CUL1; NR1D1; RGN;
Blocking Peptide:
For anti-NR1D2 (ARP74677_P050-FITC) antibody is Catalog # AAP74677
Datasheets/Manuals:
Printable datasheet for anti-NR1D2 (ARP74677_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...