Search Antibody, Protein, and ELISA Kit Solutions

NQO2 Antibody - N-terminal region (ARP81040_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
NQO2
Official Gene Full Name:
NAD(P)H dehydrogenase, quinone 2
NCBI Gene Id:
4835
Protein Name:
ribosyldihydronicotinamide dehydrogenase [quinone]
Swissprot Id:
P16083
Protein Accession #:
NP_000895.2
Nucleotide Accession #:
NM_000904.4
Alias Symbols:
QR2, DHQV, DIA6, NMOR2
Description of Target:
This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
231
Molecular Weight:
25 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NQO2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NQO2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NQO2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NQO2 (ARP81040_P050) antibody is Catalog # AAP81040
Datasheets/Manuals:
Printable datasheet for anti-NQO2 (ARP81040_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...