Search Antibody, Protein, and ELISA Kit Solutions

NPY5R Antibody - N-terminal region (ARP76423_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
NPY5R
Official Gene Full Name:
neuropeptide Y receptor Y5
NCBI Gene Id:
4889
Protein Name:
neuropeptide Y receptor type 5
Swissprot Id:
Q15761
Protein Accession #:
NP_006165.1
Nucleotide Accession #:
NM_006174.3
Alias Symbols:
NPYR5, NPY5-R, NPYY5-R,
Replacement Item:
This antibody may replace item sc-137167 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved in a pathway that protects neuroblastoma cells from chemotherapy-induced cell death, providing a possible therapeutic target against neuroblastoma. Three transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
445
Molecular Weight:
49 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NPY5R.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NPY5R.
Immunogen:
The immunogen is a synthetic peptide directed towards the N region of human NPY5R
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NPY5R (ARP76423_P050) antibody is Catalog # AAP76423
Datasheets/Manuals:
Printable datasheet for anti-NPY5R (ARP76423_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...