NPY4R Antibody - N-terminal region : HRP (ARP66644_P050-HRP)

Catalog No: ARP66644_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPY4R
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: SIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NPY4R (ARP66644_P050-HRP) antibody is Catalog # AAP66644

Target Info

• Gene Symbol: NPY4R
• Alias Symbols: Y4, PP1, PPYR1, NPY4-R
• NCBI Gene Id: 5540
• Description of Target: NPY4R is a receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PP, PP (2-36) and [Ile-31, Gln-34] PP > [Pro-34] PYY > PYY and [Leu-31, Pro-34] NPY > NPY > PYY (3-36) and NPY (2-36) > PP (13- 36) > PP (31-36) > NPY free acid.
• Uniprot ID: P50391
• Protein Accession #: XP_005277701
• Protein Size (# AA): 375
• Molecular Weight: 41kDa
• Protein Interactions: PYY; PPY; NPY;