NPTX2 Antibody - middle region (ARP81743_P050)

Catalog No: ARP81743_P050

Host: Rabbit
Target Name: NPTX2
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPTX2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NPTX2 (ARP81743_P050) antibody is Catalog # AAP81743

Target Info

• Gene Symbol: NPTX2
• Gene Full Name: neuronal pentraxin II
• Alias Symbols: NP2, NARP, NP-II
• NCBI Gene Id: 4885
• Protein Name: neuronal pentraxin-2
• Description of Target: This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD.
• Uniprot ID: P47972
• Protein Accession #: NP_002514.1
• Nucleotide Accession #: NM_002523.2
• Protein Size (# AA): 431
• Molecular Weight: 47 kDa