NPPA Antibody - middle region (ARP80859_P050)

Catalog No: ARP80859_P050

Host: Rabbit
Target Name: NPPA
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPPA
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NPPA (ARP80859_P050) antibody is Catalog # AAP80859

Target Info

• Gene Symbol: NPPA
• Gene Full Name: natriuretic peptide A
• Alias Symbols: ANF, ANP, CDD, CDP, PND, ATFB6, ATRST2, CDD-ANF
• NCBI Gene Id: 4878
• Protein Name: natriuretic peptides A
• Description of Target: The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. This gene is located adjacent to another member of the natriuretic family of peptides on chromosome 1.
• Uniprot ID: P01160
• Protein Accession #: NP_006163.1
• Nucleotide Accession #: NM_006172.3
• Protein Size (# AA): 153
• Molecular Weight: 16 kDa