NOX4 Recombinant Protein (Rat) (OPCA05196)

Catalog No: OPCA05196

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Rattus norvegicus (Rat)
• Reconstitution and Storage: Store at -20°C or -80°C. Avoid freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
• Protein Sequence: GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 210-424 aa
• Tag: N-terminal 6xHis-B2M-tagged

Target Info

• Reference: Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase. Ambasta R.K., Kumar P., Griendling K.K., Schmidt H.H.H.W., Busse R., Brandes R.P. J. Biol. Chem. 279:45935-45941(2004)
• Gene Symbol: Nox4
• Gene Full Name: NADPH oxidase 4
• Alias Symbols: kidney oxidase-1;kidney superoxide-producing NADPH oxidase;kox-1;NADPH oxidase 4.
• NCBI Gene Id: 85431
• Protein Name: NADPH oxidase 4
• Description of Target: Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
• Uniprot ID: Q924V1
• Protein Accession #: NP_445976
• Nucleotide Accession #: NM_053524
• Protein Size (# AA): Recombinant
• Molecular Weight: 38.6 kDa