Search Antibody, Protein, and ELISA Kit Solutions

NOX4 Antibody - C-terminal region : FITC (ARP75556_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75556_P050 Unconjugated

ARP75556_P050-HRP Conjugated

ARP75556_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-21860 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NOX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NOX4.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NOX4
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: LLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NOX4 (ARP75556_P050-FITC) antibody is Catalog # AAP75556
Printable datasheet for anti-NOX4 (ARP75556_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...