Search Antibody, Protein, and ELISA Kit Solutions

NOX1 Antibody - C-terminal region (ARP46818_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46818_P050-FITC Conjugated

ARP46818_P050-HRP Conjugated

ARP46818_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NOX1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-NOX1 (ARP46818_P050)
Peptide Sequence:
Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NOX1 (ARP46818_P050) antibody is Catalog # AAP46818 (Previous Catalog # AAPP27616)
Datasheets/Manuals:
Printable datasheet for anti-NOX1 (ARP46818_P050) antibody
Target Reference:
Kuwano,Y., Am. J. Physiol., Cell Physiol. 290 (2), C433-C443 (2006)
Publications:

Rayegan, S; Dehpour, AR; Sharifi, AM; Studying neuroprotective effect of Atorvastatin as a small molecule drug on high glucose-induced neurotoxicity in undifferentiated PC12 cells: role of NADPH oxidase. 32, 41-49 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27476541

Gene Symbol:
NOX1
Official Gene Full Name:
NADPH oxidase 1
Alias Symbols:
GP91-2, MOX1, NOH-1, NOH1
NCBI Gene Id:
27035
Protein Name:
NADPH oxidase 1
Description of Target:
Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox. Three splice variants of NOX1 have been identified, NOH-1L, NOH-1S and NOH-1Lv. The NOH-1S currents were reversibly blocked by zinc, a known H+ channel inhibitor. The NOH-1S variant does not contain an electron transport chain and it is thought that H+ conductance is its main physiologic function, whereas NOH-1L may conduct H+ ions as part of its electron transport mechanism.
Swissprot Id:
Q9Y5S8
Protein Accession #:
NP_008983
Nucleotide Accession #:
NM_007052
Protein Size (# AA):
564
Molecular Weight:
65kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NOX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NOX1.
Protein Interactions:
NOXA1; CYBA;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...