- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for anti-NOTO (ARP51005_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human NOTO |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: CSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-NOTO (ARP51005_P050) antibody is Catalog # AAP51005 |
| Gene Symbol | NOTO |
|---|---|
| Alias Symbols | NOTO, |
| NCBI Gene Id | 344022 |
| Description of Target | NOTO is a transcription regulator acting downstream of both FOXA2 and T during notochord development. It is required for node morphogenesis. It is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; it acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. And it plays a role in regulating axial versus paraxial cell fate (By similarity). |
| Uniprot ID | A8MTQ0 |
| Protein Accession # | NP_001127934 |
| Protein Size (# AA) | 251 |
| Molecular Weight | 27kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NOTO Antibody - C-terminal region (ARP51005_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "NOTO Antibody - C-terminal region (ARP51005_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "NOTO Antibody - C-terminal region (ARP51005_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NOTO Antibody - C-terminal region (ARP51005_P050)"?
This target may also be called "NOTO, " in publications.
-
What is the shipping cost for "NOTO Antibody - C-terminal region (ARP51005_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NOTO Antibody - C-terminal region (ARP51005_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NOTO Antibody - C-terminal region (ARP51005_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "27kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NOTO Antibody - C-terminal region (ARP51005_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NOTO"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NOTO"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NOTO"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NOTO"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NOTO"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NOTO"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
