NOTCH4 Antibody - middle region (ARP32052_P050)

Catalog No: ARP32052_P050

WB Suggested Anti-NOTCH4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOTCH4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 77%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Pig: 100%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: KALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NOTCH4 (ARP32052_P050) antibody is Catalog # AAP32052 (Previous Catalog # AAPP23944)
• Reference: Tang,Y., (2008) Circ. Res. 102 (6), 661-668

Target Info

• Gene Symbol: NOTCH4
• Gene Full Name: Notch 4
• Alias Symbols: INT3
• NCBI Gene Id: 4855
• Protein Name: Neurogenic locus notch homolog protein 4
• Description of Target: NOTCH4 is a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. NOTCH4 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH4 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. NOTCH4 gene may be associated with susceptibility to schizophrenia in a small portion of cases. This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. This gene may be associated with susceptibility to schizophrenia in a small portion of cases. An alternative splice variant has been described but its biological nature has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q99466
• Protein Accession #: NP_004548
• Nucleotide Accession #: NM_004557
• Protein Size (# AA): 2003
• Molecular Weight: 58kDa
• Protein Interactions: EGFL7; Dlg4; SMAD4; SMAD3; SMAD2; TCEB1; UBC; TP53; MDM2; MAML3; MAML2; FBXW7; MAML1; DLL4; PSEN2; NOTCH4; RBPJ; PSEN1;