NOTCH4 Antibody - C-terminal region : Biotin (ARP38498_P050-Biotin)

Catalog No: ARP38498_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NOTCH4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NOTCH4 (ARP38498_P050-Biotin) antibody is Catalog # AAP38498

Target Info

• Gene Symbol: NOTCH4
• Gene Full Name: Notch 4
• Alias Symbols: INT3
• NCBI Gene Id: 4855
• Protein Name: Neurogenic locus notch homolog protein 4
• Description of Target: NOTCH4 is a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. NOTCH4 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH4 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. NOTCH4 gene may be associated with susceptibility to schizophrenia in a small portion of cases.
• Uniprot ID: Q99466
• Protein Accession #: NP_004548
• Nucleotide Accession #: NM_004557
• Protein Size (# AA): 2003
• Molecular Weight: 58kDa
• Protein Interactions: EGFL7; Dlg4; SMAD4; SMAD3; SMAD2; TCEB1; UBC; TP53; MDM2; MAML3; MAML2; FBXW7; MAML1; DLL4; PSEN2; NOTCH4; RBPJ; PSEN1;