Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP38498_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38498_P050-FITC Conjugated

ARP38498_P050-HRP Conjugated

ARP38498_P050-Biotin Conjugated

NOTCH4 Antibody - C-terminal region (ARP38498_P050)

Catalog#: ARP38498_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-32612 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NOTCH4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-NOTCH4 (ARP38498_P050)
Peptide Sequence Synthetic peptide located within the following region: CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NOTCH4 (ARP38498_P050) antibody is Catalog # AAP38498
Datasheets/Manuals Printable datasheet for anti-NOTCH4 (ARP38498_P050) antibody
Gene Symbol NOTCH4
Official Gene Full Name Notch 4
Alias Symbols INT3, NOTCH4
NCBI Gene Id 4855
Protein Name Neurogenic locus notch homolog protein 4
Description of Target NOTCH4 is a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. NOTCH4 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH4 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. NOTCH4 gene may be associated with susceptibility to schizophrenia in a small portion of cases.
Swissprot Id Q99466
Protein Accession # NP_004548
Nucleotide Accession # NM_004557
Protein Size (# AA) 2003
Molecular Weight 58kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NOTCH4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NOTCH4.
Protein Interactions EGFL7; Dlg4; SMAD4; SMAD3; SMAD2; TCEB1; UBC; TP53; MDM2; MAML3; MAML2; FBXW7; MAML1; DLL4; PSEN2; NOTCH4; RBPJ; PSEN1;
  1. What is the species homology for "NOTCH4 Antibody - C-terminal region (ARP38498_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "NOTCH4 Antibody - C-terminal region (ARP38498_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NOTCH4 Antibody - C-terminal region (ARP38498_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NOTCH4 Antibody - C-terminal region (ARP38498_P050)"?

    This target may also be called "INT3, NOTCH4" in publications.

  5. What is the shipping cost for "NOTCH4 Antibody - C-terminal region (ARP38498_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NOTCH4 Antibody - C-terminal region (ARP38498_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NOTCH4 Antibody - C-terminal region (ARP38498_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NOTCH4 Antibody - C-terminal region (ARP38498_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NOTCH4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NOTCH4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NOTCH4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NOTCH4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NOTCH4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NOTCH4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NOTCH4 Antibody - C-terminal region (ARP38498_P050)
Your Rating