Search Antibody, Protein, and ELISA Kit Solutions

NOTCH4 Antibody - C-terminal region (ARP38498_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38498_P050-FITC Conjugated

ARP38498_P050-HRP Conjugated

ARP38498_P050-Biotin Conjugated

Gene Symbol:
NOTCH4
Official Gene Full Name:
Notch 4
NCBI Gene Id:
4855
Protein Name:
Neurogenic locus notch homolog protein 4
Swissprot Id:
Q99466
Protein Accession #:
NP_004548
Nucleotide Accession #:
NM_004557
Alias Symbols:
INT3, NOTCH4
Replacement Item:
This antibody may replace item sc-32612 from Santa Cruz Biotechnology.
Description of Target:
NOTCH4 is a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. NOTCH4 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH4 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. NOTCH4 gene may be associated with susceptibility to schizophrenia in a small portion of cases.
Protein Size (# AA):
2003
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NOTCH4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NOTCH4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NOTCH4
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-NOTCH4 (ARP38498_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EGFL7; Dlg4; SMAD4; SMAD3; SMAD2; TCEB1; UBC; TP53; MDM2; MAML3; MAML2; FBXW7; MAML1; DLL4; PSEN2; NOTCH4; RBPJ; PSEN1;
Blocking Peptide:
For anti-NOTCH4 (ARP38498_P050) antibody is Catalog # AAP38498
Datasheets/Manuals:
Printable datasheet for anti-NOTCH4 (ARP38498_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...