Search Antibody, Protein, and ELISA Kit Solutions

NOTCH2 Antibody - middle region (ARP32723_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32723_P050-FITC Conjugated

ARP32723_P050-HRP Conjugated

ARP32723_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Notch 2
NCBI Gene Id:
Protein Name:
Neurogenic locus notch homolog protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-32344 from Santa Cruz Biotechnology.
Description of Target:
NOTCH2 is a member of the Notch family. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. NOTCH2 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH2 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development.This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NOTCH2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NOTCH2.
The immunogen is a synthetic peptide directed towards the middle region of human NOTCH2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-NOTCH2 (ARP32723_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NOTCH2 (ARP32723_P050) antibody is Catalog # AAP32723 (Previous Catalog # AAPP03737)
Printable datasheet for anti-NOTCH2 (ARP32723_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that NOTCH2 is expressed in 721_B

Target Reference:
Troen,G., (er) Haematologica (2008) In press

Tilley, A. E. et al. Down-regulation of the notch pathway in human airway epithelium in association with smoking and chronic obstructive pulmonary disease. Am. J. Respir. Crit. Care Med. 179, 457-66 (2009). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat 19106307

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...