NOS3 Recombinant Protein (Rat) (OPCA01106)

Catalog No: OPCA01106

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : His tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ
• Protein Sequence: ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 519-690 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Cloning and expression of the rat endothelial nitric oxide synthase.Seidel B., Jiang L., Wolf G. Differential expression and induction of mRNAs encoding two inducible nitric oxide synthases in rat kidney.Mohaupt M.G., Elzie J.L., Ahn K.Y., Clapp W.L., Wilcox C.S., Kone B.C.Kidney Int. 46:653-665(1994)
• Gene Symbol: Nos3
• Gene Full Name: nitric oxide synthase 3
• Alias Symbols: cNOS;constitutive NOS;EC-NOS;endothelial nitric oxide synthase 3;endothelial NOS;eNos;nitric oxide synthase 3, endothelial cell;nitric oxide synthase, endothelial;NOS type III;NOSIII.
• NCBI Gene Id: 24600
• Protein Name: Nitric oxide synthase, endothelial
• Description of Target: Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
• Uniprot ID: Q62600
• Protein Size (# AA): Recombinant
• Molecular Weight: 22.9 kDa