Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP63000_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63000_P050-FITC Conjugated

ARP63000_P050-HRP Conjugated

ARP63000_P050-Biotin Conjugated

NOS2 Antibody - N-terminal region (ARP63000_P050)

Rating:
80% of 100
Catalog#: ARP63000_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-49055 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-NOS2 (ARP63000_P050)
Peptide Sequence Synthetic peptide located within the following region: PCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NOS2 (ARP63000_P050) antibody is Catalog # AAP63000
Datasheets/Manuals Printable datasheet for anti-NOS2 (ARP63000_P050) antibody
Gene Symbol NOS2
Official Gene Full Name Nitric oxide synthase 2, inducible
Alias Symbols HEP-NOS, INOS, NOS, NOS2A
NCBI Gene Id 4843
Protein Name Nitric oxide synthase, inducible
Description of Target Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.
Swissprot Id P35228
Protein Accession # EAW51048
Nucleotide Accession # NM_000625
Protein Size (# AA) 997
Molecular Weight 110kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NOS2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NOS2.
Protein Interactions CUL5; SPSB2; NOS2; CALM1; HSP90AA1; CCT7; AGR2; CDIPT; DNAJA2; PSMD14; HUWE1; PSMD6; BAG2; RPL23; AIFM1; DNAJA3; HERC1; SLC7A5; YWHAZ; YWHAG; YWHAE; XRCC5; VCP; UBC; DNAJC7; CCT3; TNFAIP2; TCP1; TCEB2; SSR4; SSBP1; TRIM21; SNRPD3; SNRPB; SMN1; SLC3A2; SKP
  1. What is the species homology for "NOS2 Antibody - N-terminal region (ARP63000_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NOS2 Antibody - N-terminal region (ARP63000_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NOS2 Antibody - N-terminal region (ARP63000_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NOS2 Antibody - N-terminal region (ARP63000_P050)"?

    This target may also be called "HEP-NOS, INOS, NOS, NOS2A" in publications.

  5. What is the shipping cost for "NOS2 Antibody - N-terminal region (ARP63000_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NOS2 Antibody - N-terminal region (ARP63000_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NOS2 Antibody - N-terminal region (ARP63000_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NOS2 Antibody - N-terminal region (ARP63000_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NOS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NOS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NOS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NOS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NOS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NOS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NOS2 Antibody - N-terminal region (ARP63000_P050)
Your Rating
We found other products you might like!