- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for NOS1AP Antibody (OAAL00474) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 3B11 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | NOS1AP (NP_055512.1, 99 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQL |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | NOS1AP |
|---|---|
| Gene Full Name | nitric oxide synthase 1 adaptor protein |
| Alias Symbols | 6330408P19Rik;CAPON;carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein;C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON);C-terminal PDZ ligand of neuronal nitric oxide synthase protein;ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain;nitric oxide synthase 1 (neuronal) adaptor protein;NPHS22. |
| NCBI Gene Id | 9722 |
| Protein Name | carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein isoform 1 [Homo sapiens]|Homo sapiens nitric oxide synthase 1 adaptor protein (NOS1AP), transcript variant 1, mRNA |
| Description of Target | This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_055512.1 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_014697 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NOS1AP Antibody (OAAL00474)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "NOS1AP Antibody (OAAL00474)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "NOS1AP Antibody (OAAL00474)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NOS1AP Antibody (OAAL00474)"?
This target may also be called "6330408P19Rik;CAPON;carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein;C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON);C-terminal PDZ ligand of neuronal nitric oxide synthase protein;ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain;nitric oxide synthase 1 (neuronal) adaptor protein;NPHS22." in publications.
-
What is the shipping cost for "NOS1AP Antibody (OAAL00474)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NOS1AP Antibody (OAAL00474)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NOS1AP Antibody (OAAL00474)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NOS1AP Antibody (OAAL00474)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NOS1AP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NOS1AP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NOS1AP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NOS1AP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NOS1AP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NOS1AP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
