Search Antibody, Protein, and ELISA Kit Solutions

NOMO1 Antibody - C-terminal region (ARP54998_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54998_P050-FITC Conjugated

ARP54998_P050-HRP Conjugated

ARP54998_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
NODAL modulator 1
NCBI Gene Id:
Protein Name:
Nodal modulator 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Nomo, PM5, NOMO3
Replacement Item:
This antibody may replace item sc-369072 from Santa Cruz Biotechnology.
Description of Target:
NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NOMO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NOMO1.
The immunogen is a synthetic peptide directed towards the C terminal region of human NOMO1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-NOMO1 (ARP54998_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NOMO1 (ARP54998_P050) antibody is Catalog # AAP54998 (Previous Catalog # AAPP32259)
Printable datasheet for anti-NOMO1 (ARP54998_P050) antibody
Sample Type Confirmation:

NOMO1 is strongly supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Lim,J., (2006) Cell 125 (4), 801-814

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...