Catalog No: ARP57279_P050
Price: $0.00
SKU
ARP57279_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NOP10 (ARP57279_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NOLA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
Concentration0.5 mg/ml
Blocking PeptideFor anti-NOP10 (ARP57279_P050) antibody is Catalog # AAP57279 (Previous Catalog # AAPP41040)
Sample Type Confirmation

NOP10 is supported by BioGPS gene expression data to be expressed in Jurkat

Subunit3
Gene SymbolNOP10
Gene Full NameNOP10 ribonucleoprotein homolog (yeast)
Alias SymbolsDKCB1, NOLA3, NOP10P
NCBI Gene Id55505
Protein NameH/ACA ribonucleoprotein complex subunit 3
Description of TargetThis gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Uniprot IDQ9NPE3
Protein Accession #NP_061118
Nucleotide Accession #NM_018648
Protein Size (# AA)64
Molecular Weight8kDa
Protein InteractionsNHP2; LIN28A; LIN28B; BMI1; SRPK3; CDK17; NAF1; DKC1; ARRB2; ARRB1; UBC; Nhp2l1; WDR48;
  1. What is the species homology for "NOLA3 Antibody - middle region (ARP57279_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "NOLA3 Antibody - middle region (ARP57279_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NOLA3 Antibody - middle region (ARP57279_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NOLA3 Antibody - middle region (ARP57279_P050)"?

    This target may also be called "DKCB1, NOLA3, NOP10P" in publications.

  5. What is the shipping cost for "NOLA3 Antibody - middle region (ARP57279_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NOLA3 Antibody - middle region (ARP57279_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NOLA3 Antibody - middle region (ARP57279_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "8kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NOLA3 Antibody - middle region (ARP57279_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NOP10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NOP10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NOP10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NOP10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NOP10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NOP10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NOLA3 Antibody - middle region (ARP57279_P050)
Your Rating