Catalog No: OPCA27655
Price: $0.00
SKU
OPCA27655
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ NODAL Recombinant Protein (Mouse) (OPCA27655)
Datasheets/Manuals | Printable datasheet for OPCA27655 |
---|
Predicted Species Reactivity | Mouse |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | HHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 245-354 |
Gene Full Name | nodal |
---|---|
Alias Symbols | Tg.413d |
NCBI Gene Id | 18119 |
Protein Name | nodal |
Description of Target | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate |
Uniprot ID | P43021 |
Protein Accession # | NP_038639.2 |
Nucleotide Accession # | NM_013611.5 |
Protein Size (# AA) | 110 |
Write Your Own Review