Search Antibody, Protein, and ELISA Kit Solutions

NOBOX Antibody - N-terminal region : FITC (ARP40110_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40110_P050 Unconjugated

ARP40110_P050-HRP Conjugated

ARP40110_P050-Biotin Conjugated

Gene Symbol:
NOBOX
Official Gene Full Name:
NOBOX oogenesis homeobox
NCBI Gene Id:
135935
Protein Accession #:
XP_001134424
Nucleotide Accession #:
XM_001134424
Alias Symbols:
OG2, OG-2, OG2X, POF5, TCAG_12042
Replacement Item:
This antibody may replace item sc-102040 from Santa Cruz Biotechnology.
Description of Target:
NOBOX is a transcription factor which may play a role in oogenesis. It binds preferentially to the DNA sequences 5'-TAATTG-3', 5'-TAGTTG-3' and 5'-TAATTA-3'.
Protein Size (# AA):
490
Molecular Weight:
54kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NOBOX.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NOBOX.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NOBOX
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-NOBOX (ARP40110_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FPVCGLYRIYGVCGSFSSFFIIRCSLCALETLKSPQHDPLEIPEQSLKLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-NOBOX (ARP40110_P050-FITC) antibody is Catalog # AAP40110 (Previous Catalog # AAPP22944)
Datasheets/Manuals:
Printable datasheet for anti-NOBOX (ARP40110_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Huntriss J, (2006) Mol Hum Reprod. 2006 May;12(5):283-9.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...