Catalog No: ARP54976_P050
Price: $0.00
SKU
ARP54976_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NOB1 (ARP54976_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NOB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE
Concentration0.5 mg/ml
Blocking PeptideFor anti-NOB1 (ARP54976_P050) antibody is Catalog # AAP54976 (Previous Catalog # AAPP32137)
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolNOB1
Gene Full NameNIN1/RPN12 binding protein 1 homolog (S. cerevisiae)
Alias SymbolsART-4, NOB1P, MST158, MSTP158, PSMD8BP1
NCBI Gene Id28987
Protein NameRNA-binding protein NOB1
Description of TargetNOB1 may play a role in mRNA degradation.
Uniprot IDQ9ULX3
Protein Accession #NP_054781
Nucleotide Accession #NM_014062
Protein Size (# AA)412
Molecular Weight47kDa
Protein InteractionsSUMO2; UBC; LIN28A; FTSJ3; RNF2; FBXO6; UPF2; VHL; APP; TXNL4B; PRNP;
  1. What is the species homology for "NOB1 Antibody - C-terminal region (ARP54976_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "NOB1 Antibody - C-terminal region (ARP54976_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NOB1 Antibody - C-terminal region (ARP54976_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NOB1 Antibody - C-terminal region (ARP54976_P050)"?

    This target may also be called "ART-4, NOB1P, MST158, MSTP158, PSMD8BP1" in publications.

  5. What is the shipping cost for "NOB1 Antibody - C-terminal region (ARP54976_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NOB1 Antibody - C-terminal region (ARP54976_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NOB1 Antibody - C-terminal region (ARP54976_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NOB1 Antibody - C-terminal region (ARP54976_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NOB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NOB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NOB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NOB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NOB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NOB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NOB1 Antibody - C-terminal region (ARP54976_P050)
Your Rating
We found other products you might like!