Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NNMT antibody - N-terminal region (ARP42281_T100)

100 ul
In Stock

Conjugation Options

ARP42281_T100-FITC Conjugated

ARP42281_T100-HRP Conjugated

ARP42281_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Nicotinamide N-methyltransferase
Protein Name:
Nicotinamide N-methyltransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Replacement Item:
This antibody may replace item sc-130829 from Santa Cruz Biotechnology.
Description of Target:
N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NNMT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NNMT.
The immunogen is a synthetic peptide directed towards the N terminal region of human NNMT
Species Reactivity:
Dog, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rat: 100%
Complete computational species homology data:
Anti-NNMT (ARP42281_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NNMT (ARP42281_T100) antibody is Catalog # AAP42281 (Previous Catalog # AAPP24646)
Printable datasheet for anti-NNMT (ARP42281_T100) antibody
Target Reference:
Roessler,M., (2005) Clin. Cancer Res. 11 (18), 6550-6557

Ulanovskaya, O. A., Zuhl, A. M. & Cravatt, B. F. NNMT promotes epigenetic remodeling in cancer by creating a metabolic methylation sink. Nat. Chem. Biol. 9, 300-6 (2013). WB, Dog, Human, Mouse, Pig, Rat 23455543

Tell us what you think about this item!

Write A Review
    Please, wait...