NNAT Antibody - middle region : FITC (ARP72421_P050-FITC)

Catalog No: ARP72421_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NNAT
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: YWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NNAT (ARP72421_P050-FITC) antibody is Catalog # AAP72421

Target Info

• Gene Symbol: NNAT
• Alias Symbols: Peg5
• NCBI Gene Id: 4826
• Description of Target: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.
• Uniprot ID: Q16517-2
• Protein Accession #: NP_859017
• Protein Size (# AA): 54
• Molecular Weight: 5kDa
• Protein Interactions: APP; NHLRC1; UBC;