NMES1 Recombinant Protein (Mouse) (OPCA03650)

Catalog No: OPCA03650

Nmes1 Recombinant Protein (Mouse) (OPCA03650) in SDS-PAGE showing the molecular weight of approximately 12.9 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Host: Mouse
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
• Protein Sequence: MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 1-83 aa
• Tag: C-terminal Flag-Myc-tagged

Target Info

• Reference: A novel gene, NMES1, downregulated in human esophageal squamous cell carcinoma.Zhou J., Wang H., Lu A., Hu G., Luo A., Ding F., Zhang J., Wang X., Wu M., Liu Z.Int. J. Cancer 101:311-316(2002)
• Gene Symbol: AA467197
• Gene Full Name: expressed sequence AA467197
• Alias Symbols: mir-147;NME;Nmes1;normal mucosa of esophagus specific 1;normal mucosa of esophagus-specific gene 1 protein.
• NCBI Gene Id: 433470
• Protein Name: Normal mucosa of esophagus-specific gene 1 protein
• Uniprot ID: Q810Q5
• Protein Accession #: NP_001004174.1
  
• Nucleotide Accession #: NM_001004174.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 12.6 kDa