NMDAR2A/B Antibody (Phospho-Tyr1246/1252) (OAAF07581)

Catalog No: OAAF07581 (Formerly GWB-ASB448)

Size:100 ug

Immunohistochemistry analysis of paraffin-embedded human brain, using NMDAR2A/B (Phospho-Tyr1246/1252) Antibody. The picture on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HUVEC cells, using NMDAR2A/B (Phospho-Tyr1246/1252) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:Y1246/Y1252 Mouse:Y1246/Y1252 Rat:Y1246/Y1252
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human NMDAR2A/B around the phosphorylation site of Tyr1246/1252.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: SCLSNMPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNPATGEQ
• Concentration: 1mg/ml
• Specificity: NMDAR2A/B (Phospho-Tyr1246/1252) Antibody detects endogenous levels of NMDAR2A/B only when phosphorylated at Tyr1246/1252.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info:
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:10000

Target Info

• Gene Symbol: GRIN2A|GRIN2B
• Gene Full Name: glutamate ionotropic receptor NMDA type subunit 2A|glutamate ionotropic receptor NMDA type subunit 2B
• Alias Symbols: DEE27;EIEE27;EPND;FESD;GluN2A;GluN2B;GluN2B(alt_5'UTR);Glutamate [NMDA] receptor subunit epsilon-1;glutamate [NMDA] receptor subunit epsilon-2;glutamate ionotropic receptor NMDA 2A;glutamate receptor ionotropic, NMDA 2A;glutamate receptor ionotropic, NMDA 2B;glutamate receptor subunit epsilon-2;glutamate receptor, ionotropic, N-methyl D-aspartate 2A;glutamate receptor, ionotropic, N-methyl D-aspartate 2B;hNR3;LKS;MRD6;NMDAR2A;NMDAR2B;N-methyl D-aspartate receptor subtype 2A;N-methyl D-aspartate receptor subtype 2B;N-methyl-D-aspartate receptor channel, subunit epsilon-1;N-methyl-D-aspartate receptor subunit 2A;N-methyl-D-aspartate receptor subunit 3;NR2A;NR2B;NR3.
• NCBI Gene Id: 2903|2904
• Protein Name: Glutamate receptor ionotropic, NMDA 2A|Glutamate receptor ionotropic, NMDA 2B
• Description of Target: Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+) (PubMed:8768735, PubMed:26919761, PubMed:26875626, PubMed:28105280). Sensitivity to glutamate and channel kinetics depend on the subunit composition; channels containing GRIN1 and GRIN2A have higher sensitivity to glutamate and faster kinetics than channels formed by GRIN1 and GRIN2B (PubMed:26919761, PubMed:26875626). Contributes to the slow phase of excitatory postsynaptic current, long-term synaptic potentiation, and learning (By similarity).|Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+) (PubMed:8768735, PubMed:26919761, PubMed:26875626, PubMed:28126851). Sensitivity to glutamate and channel kinetics depend on the subunit composition (PubMed:8768735, PubMed:26875626). In concert with DAPK1 at extrasynaptic sites, acts as a central mediator for stroke damage. Its phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity inducing injurious Ca2+ influx through them, resulting in an irreversible neuronal death. Contributes to neural pattern formation in the developing brain. Plays a role in long-term depression (LTD) of hippocampus membrane currents and in synaptic plasticity (By similarity).
• Uniprot ID: Q12879|Q13224
• Molecular Weight: 165 kDa