- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-NMBR (ARP58501_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NMBR |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-NMBR (ARP58501_P050) antibody is Catalog # AAP58501 (Previous Catalog # AAPP34815) |
Reference | Matusiak,D., Am. J. Physiol. Gastrointest. Liver Physiol. 288 (4), G718-G728 |
---|---|
Gene Symbol | NMBR |
Gene Full Name | Neuromedin B receptor |
Alias Symbols | BB1, BB1R, NMB-R |
NCBI Gene Id | 4829 |
Protein Name | Neuromedin-B receptor |
Description of Target | Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-100 AL589674.9 90178-90277 c 101-1308 M73482.1 99-1306 1309-1354 AL589674.9 77086-77131 c This locus represents an antisense transcript of the survivin locus. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 AF086186.1 11-280 271-869 AC087645.19 118062-118660 870-1098 L26245.1 740-968 1099-1286 BM839824.1 1-188 c |
Uniprot ID | P28336 |
Protein Accession # | NP_002502 |
Nucleotide Accession # | NM_002511 |
Protein Size (# AA) | 390 |
Molecular Weight | 43kDa |
Protein Interactions | NMB; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NMBR Antibody - N-terminal region (ARP58501_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "NMBR Antibody - N-terminal region (ARP58501_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "NMBR Antibody - N-terminal region (ARP58501_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NMBR Antibody - N-terminal region (ARP58501_P050)"?
This target may also be called "BB1, BB1R, NMB-R" in publications.
-
What is the shipping cost for "NMBR Antibody - N-terminal region (ARP58501_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NMBR Antibody - N-terminal region (ARP58501_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NMBR Antibody - N-terminal region (ARP58501_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "43kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NMBR Antibody - N-terminal region (ARP58501_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NMBR"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NMBR"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NMBR"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NMBR"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NMBR"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NMBR"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.